frddlmZmZmZddlZddlZddlZddlZddlm Z e  ddl m Z ddlmZddlmZmZmZej(dZGdd ZGd dZGd d eZGd deZGddeZGddeZGddeZGddZy#e $r Z YdZ [ dZ [ wwxYw))divisionprint_functionunicode_literalsN)require_gi_versions)AtspiTextSpan)KeyCode Modifiers unicode_str TextDomainc"eZdZdZdZdZdZy) TextDomainsz, Collection of all recognized text domains. clttttt g|_yN)DomainTerminal DomainURLDomainPasswordDomainGenericText DomainNOP_domainsselfs 4/usr/lib/python3/dist-packages/Onboard/TextDomain.py__init__zTextDomains.__init__+s)()"')*,"  c R|jD]}|jdi|s|cSy)N)rmatches)rkwargsdomains r find_matchzTextDomains.find_match5s0mm Fv~~''  rc |jdS)N)rrs rget_nop_domainzTextDomains.get_nop_domain;s}}R  rN)__name__ __module__ __qualname____doc__rr"r%rrrrr(s6 !rrceZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdZej(dej*ZdZy)r zN Abstract base class as a catch-all for domain specific functionalty. c"t|_yr)PartialURLParser _url_parserrs rrzTextDomain.__init__Ds +-rc *d|jdgvS)NText interfacesgetrr s rrzTextDomain.matchesGsL"555rcy)z: Called on being selected as the currently active domain. Nrrs r init_domainzTextDomain.init_domainLs rctSr)NotImplementedErrorrkeyboard accessibles r read_contextzTextDomain.read_contextPs "$$rcy)Nrrs rget_text_begin_markerz TextDomain.get_text_begin_markerSsrcTd}tjd|}|r|d}|jj|r|jj |}|S|j |}|r|}|jj |r d|z}|jj |}|S)a Get word separator to add after inserting a prediction choice. Doctests: >>> from os.path import join # URL >>> d = DomainGenericText() >>> d.get_auto_separator("word http") ' ' >>> d.get_auto_separator("word http://www") '.' >>> d.get_auto_separator("word http://www.domain.org/path") '/' >>> d.get_auto_separator("word http://www.domain.org/path/document.ext") '' # filename >>> import tempfile >>> from os.path import abspath, dirname, join >>> def touch(fn): ... with open(fn, mode="w") as f: n = f.write("") >>> td = tempfile.TemporaryDirectory(prefix="test_onboard _") >>> dir = td.name >>> touch(join(dir, "onboard-defaults.conf.example")) >>> touch(join(dir, "onboard-defaults.conf.example.another")) >>> >>> d.get_auto_separator("/etc") '/' >>> d.get_auto_separator(join(dir, "onboard-defaults")) '.' >>> d.get_auto_separator(join(dir, "onboard-defaults.conf")) '.' >>> d.get_auto_separator(join(dir, "onboard-defaults.conf.example")) '' >>> d.get_auto_separator(join(dir, "onboard-defaults.conf.example.another")) ' ' # filename in directory with spaces >>> import tempfile >>> td = tempfile.TemporaryDirectory(prefix="test onboard _") >>> dir = td.name >>> fn = os.path.join(dir, "onboard-defaults.conf.example") >>> touch(fn) >>> d.get_auto_separator(join(dir, "onboard-defaults")) '.' # no false positives for valid filenames before the current token >>> d.get_auto_separator(dir + "/onboard-defaults no-file") ' '  z(\s+)r$file://)resplitr- is_maybe_urlget_auto_separator_search_valid_file_name_is_maybe_filename)rcontext separatorstringsstringfnurls rrEzTextDomain.get_auto_separatorVsl ((8W- R[F,,V4 ,,??G 11':F##66v>#f,C $ 0 0 C CC HIrcvd}tt|t|D]}dj|d|z d}|jj |s6t jj|sVt jj|r|cStj|dz}|s|cSy)aT Search for a valid filename backwards across separators. Doctests: >>> import tempfile, re, os.path >>> >>> d = DomainGenericText() >>> >>> td = tempfile.TemporaryDirectory(prefix="test onboard _") >>> dir = td.name >>> fn1 = os.path.join(dir, "file") >>> fn2 = os.path.join(dir, "file with many spaces") >>> with open(fn1, mode="w") as f: n = f.write("") >>> with open(fn2, mode="w") as f: n = f.write("") # simple file in dir with spaces must return as filename >>> strings = re.split(r'(\s+)', fn1) >>> "/test onboard" in d._search_valid_file_name(strings) True # file with spaces in dir with spaces must return as filename >>> strings = re.split(r'(\s+)', fn2) >>> "/test onboard" in d._search_valid_file_name(strings) True # random string after a valid file must not be confused with a filename >>> strings = re.split(r'(\s+)', fn2 + " no-file") >>> d._search_valid_file_name(strings) is None True r=r$N*) rangeminlenjoinr-rGospathisabsexistsglob)rrJ max_sectionsirLfiless rrFz"TextDomain._search_valid_file_names@ s<W67 AA(B2226ww}}R 77>>"%I28,I "rc|j}|j}|j|z }|j|z }|j |\}}t |D]v\}} || dks|| dkDs||} ||} |j j| s|j j| sYt|| d}t|| d}x||z||z |||fS)a Grow span before learning to include e.g. whole URLs. Doctests: >>> d = DomainGenericText() # Span doesn't grow for simple words >>> d.grow_learning_span(TextSpan(8, 1, "word1 word2 word3")) (8, 1, 'r') # Span grows to include a complete URL >>> d.grow_learning_span(TextSpan(13, 1, "http://www.domain.org")) (0, 21, 'http://www.domain.org') # Span grows to include multiple complete URLs >>> d.grow_learning_span(TextSpan(19, 13, "http://www.domain.org word http://slashdot.org")) (0, 46, 'http://www.domain.org word http://slashdot.org') # Span grows to include a complete filename >>> d.grow_learning_span(TextSpan(10, 1, "word1 /usr/bin/bash word2")) (6, 13, '/usr/bin/bash') # Edge cases >>> d.grow_learning_span(TextSpan(6, 0, "word1 /usr/bin/bash word2")) (6, 0, '') >>> d.grow_learning_span(TextSpan(19, 0, "word1 /usr/bin/bash word2")) (19, 0, '') >>> d.grow_learning_span(TextSpan(6, 1, "word1 /usr/bin/bash word2")) (6, 13, '/usr/bin/bash') >>> d.grow_learning_span(TextSpan(18, 1, "word1 /usr/bin/bash word2")) (6, 13, '/usr/bin/bash') # Large text with text offset>0: returned position must be offset too >>> d.grow_learning_span(TextSpan(116, 1, ... "word1 /usr/bin/bash word2", 100)) (106, 13, '/usr/bin/bash') r) get_text text_beginbeginend_split_growth_sections enumerater-rDrGrRmax) r text_spantextoffsetrarbsectionsspansr[ssectionspans rgrow_learning_spanzTextDomain.grow_learning_spansL##%%%'"V+6)55d;%e$ ,DAqqt|ad "1+Qx##009##66w?tAw/Ec47+C ,v~sU{DsO;;rcyNTr)rr:poslengths rcan_record_insertionzTextDomain.can_record_insertion rcyrprrs rcan_give_keypress_feedbackz%TextDomain.can_give_keypress_feedbackrtrcyNFrr section_spans rcan_spell_checkzTextDomain.can_spell_checkrcyrxrrys rcan_auto_correctzTextDomain.can_auto_correctr|rcyrxrrhas_begin_of_texts rcan_auto_punctuatezTextDomain.can_auto_punctuater|rcy)6 Can give word suggestions before typing has started? Trrs rcan_suggest_before_typingz$TextDomain.can_suggest_before_typingsrcy)NTNrrkeycodemod_masks rhandle_key_presszTextDomain.handle_key_press srz [^\s?#@]+c|jj|}g}g}|D]@}|j|j|j|j B||fS)a Split text at whitespace and other delimiters where growing learning spans should stop. Doctests: >>> d = DomainGenericText() >>> d._split_growth_sections("word1 www.domain.org word2. http://test") (['word1', 'www.domain.org', 'word2.', 'http://test'], [(0, 5), (6, 20), (21, 27), (28, 39)]) >>> d._split_growth_sections("http://www.domain.org/?p=1#anchor") (['http://www.domain.org/', 'p=1', 'anchor'], [(0, 22), (23, 26), (27, 33)]) >>> d._split_growth_sections("http://user:pass@www.domain.org") (['http://user:pass', 'www.domain.org'], [(0, 16), (17, 31)]) )_growth_sections_patternfinditerappendgrouprm)rrgrtokensrjms rrcz!TextDomain._split_growth_sections%sc //88> #A MM!'') $ LL " #u}rN)r&r'r(r)rrr5r;r>rErFrnrsrvr{r~rrrrBcompileDOTALLrrcrrrr r ?st.6  %GT2h7s5/rrceZdZdZdZdZy)rz( Do-nothing domain for password entries c Z|jdtjjk(SNrole)r2rRole PASSWORD_TEXTr3s rrzDomainPassword.matchesOs zz&!UZZ%=%===rcyrxrrs rrvz)DomainPassword.can_give_keypress_feedbackRr|rN)r&r'r(r)rrvrrrrrLs2>rrc4eZdZdZdZdZdZdZdZdZ y) rz' Default domain for generic text entry c .tj|fi|Sr)r rr3s rrzDomainGenericText.matchesYs!!$1&11rcl|j} |j}|@|j}|dkr'tj dj |||}||f}|j |dtjj}t|jjdd}t|d|j z d} t|ddz d} t#|ddz|} |j%| | } t| } t'|d|d |dz | | } | d|d| z }| dk(}d}||| | ||fS#t$r+}tjdt|zYd}~yd}~wwxYw#t$r+}tjd t|zYd}~yd}~wwxYw) z0 Extract prediction context from the accessible NrzDomainGenericText.read_context(): Atspi.Text.get_caret_offset() returned invalid {}. Pretending the cursor is at the end of the text at offset {}.z(DomainGenericText.read_context(), text:  r=dz)DomainGenericText.read_context(), text2: r^) get_selectionget_character_countget_caret_offset_loggerwarningformatget_text_at_offsetrTextBoundaryType LINE_START Exceptioninfor contentreplacere start_offsetrRr_r )rr9r: selectioncountrhrexline line_caretrarbrgselection_spanrH begin_of_textbegin_of_text_offsets rr;zDomainGenericText.read_context\s,,.  224E #446 A:OO%@ &,VFE%: < #F#V, --! e44??AA199%--dB716: IaL3&*IaL3&. &&uc2D4 ")A, ! y|0K"&/, ! u,-  z>35 5;  LLC$R) *    LLD$R) *  s0A?E7E? E<!E77E<? F3!F..F3c|j}|jj| xr|jj| S)aF Can we auto-correct this span?. Doctests: >>> d = DomainGenericText() >>> d.can_spell_check(TextSpan(0, 3, "abc")) True >>> d.can_spell_check(TextSpan(4, 3, "abc def")) True >>> d.can_spell_check(TextSpan(0, 20, "http://www.domain.org")) False ) get_span_textr-rDrG)rrzrls rr{z!DomainGenericText.can_spell_checksL,,.##0099@##66w?? @rc$|j|S)z1 Can we auto-correct this span?. )r{rys rr~z"DomainGenericText.can_auto_corrects##L11rcyrprrs rrz$DomainGenericText.can_auto_punctuatertrcy)Nz rrs rr>z'DomainGenericText.get_text_begin_markerrN) r&r'r(r)rr;r{r~rr>rrrrrVs$12;5z$2 rrceZdZdZeddDZeddDZdZdZdZ dd Z d Z d Z d Z dZdZdZdZy )rz. Terminal entry, in particular gnome-terminal c#dK|](}tj|tj*ywrrBrUNICODE.0ps r zDomainTerminal.s# 1RZZ2::6 .0) z^gdb$ z^>>> z^In \[[0-9]*\]: z^:z^/z^\?z\$ z# z^.*?@.*?/.*?> c#dK|](}tj|tj*ywrrrs rrzDomainTerminal.s#'Qrzz!RZZ'@'r)z ^\(.*\)`.*': c tj|fi|xr,|jdtjj k(Sr)r rr2rrTERMINALr3s rrzDomainTerminal.matchess:!!$1&19zz&!UZZ%8%88 9rcyrrrs rr5zDomainTerminal.init_domains rc  |j}|j |||j \}}}}} |rd} |} nd} d} dj|} dj|dd} t|d| |z|t| z }| || || | f}|S#t$r+}tjdt |zYd}~yd}~wwxYw)z@ Extract prediction context from the accessible zDomainTerminal.read_context(): NTFr=r$r) rrrrr _get_text_after_promptget_last_typed_was_separatorrTr rS)rr9r:rhr context_lines prompt_lengthr line_startrrrrH before_linerresults rr;zDomainTerminal.read_contexts 002F  ' 'F557 9 C }dJ  M#- !M#' ''-(ggmCR01 !&!"-"4",s;/?"?A4^!57 5  LL:$R) *  sB C!B??CNcL|j|tjj}t |j }|j }||z }g}d} |d|} ||ddk(r|r|jr| dz } tdD]} |j| rg}d} n|j| } |jd| | d| dk(r|| d}|| z }|| z}| rnA|j|tjj}t |j } || |||f} | S)a  Return text from the input area of the terminal after the prompt. Doctests: >>> class AtspiTextRangeMockup: ... pass >>> class AccessibleMockup: ... def __init__(self, text, width): ... self._text = text ... self._width = width ... def get_text_at_offset(self, offset, boundary): ... line = offset // self._width ... lbegin = line * self._width ... r = AtspiTextRangeMockup() ... r.content = self._text[lbegin:lbegin+self._width] ... r.start_offset = lbegin ... return r ... def get_text_before_offset(self, offset, boundary): ... return self.get_text_at_offset(offset - self._width, boundary) ... def is_byobu(self): ... return False >>> d = DomainTerminal() # Single line >>> a = AccessibleMockup("abc$ ls /etc\n", 15) >>> d._get_text_after_prompt(a, 12) (['ls /etc'], 5, 'ls /etc\n', 5, 7) # Two lines >>> a = AccessibleMockup("abc$ ls /e" ... "tc\n", 10) >>> d._get_text_after_prompt(a, 12) (['ls /e', 'tc'], 5, 'tc\n', 10, 2) # Three lines: prompt not detected # More that two lines are not supported. The probability of detecting # "prompts" in random scrolling data rises with each additional line. >>> a = AccessibleMockup("abc$ ls /e" ... "tc/X11/xor" ... "g.conf.d\n", 10) >>> d._get_text_after_prompt(a, 28) (['tc/X11/xor', 'g.conf.d'], 0, 'g.conf.d\n', 20, 8) # Two lines with slash at the beginning of the second: detect vi # search prompt. Not ideal, but vi is important too. >>> a = AccessibleMockup("abc$ ls /etc" ... "/X11\n", 12) >>> d._get_text_after_prompt(a, 16) (['X11'], 1, 'X11\n', 13, 3) Nrr@r) rrrrr rris_byoburQ_find_blacklisted_prompt _find_promptinsertget_text_before_offset) rr: caret_offsetlast_typed_was_separatorrrrrrrlr[rs rrz%DomainTerminal._get_text_after_promptsVn  ) ) %00;; =199%^^ !J.   *    $ #    HAq 'A,,Q/ " $  --a0M  Amn$5 6AvMN+m+ m+ 11e44??AAAII&A+ '.  J0 rcp|jD]'}|j|}|s|jcSy)z Search for a prompt and return the offset where the user input starts. Until we find a better way just look for some common prompt patterns. r)_prompt_patternssearchrbrrHpatternmatchs rrzDomainTerminal._find_prompt]s; ,, #GNN7+Eyy{" #rcp|jD]'}|j|}|s|jcSyr)_prompt_blacklist_patternsrrbrs rrz'DomainTerminal._find_blacklisted_prompths966 #GNN7+Eyy{" #rcy)Nz rrs rr>z$DomainTerminal.get_text_begin_markerosrcH|j||\}}}}}t|Sr)rbool) rr:rhrrrrrrrs rrsz#DomainTerminal.can_record_insertionrs/  ' ' F ; C }dJ M""rcy)rFrrs rrz(DomainTerminal.can_suggest_before_typingzsrc|tjk(s|tjk(ry|tjk(r|tj zryy)z End recording and learn when pressing [Return] because text that is scrolled out of view is lost in a terminal. )FT)FFr)r ReturnKP_EnterCr CTRLrs rrzDomainTerminal.handle_key_presss> gnn $ g&& &  !h&?rc| S)z Only auto-punctuate in Terminal when no prompt was detected. Intention is to allow punctuation assistance in editors, but disable it when entering commands at the prompt, e.g. for "cd ..". rrs rrz!DomainTerminal.can_auto_punctuates %$$rr)r&r'r(r)tuplerrrr5r;rrrr>rsrrrrrrrrsz8  !"  "''!"'" 9  F9=cJ # %rrc(eZdZdZdZdZdZdZy)rz (Firefox) address bar c &|jddS)N is_urlbarFr1r3s rrzDomainURL.matchesszz+u--rc8|jj|S)zP Get word separator to add after inserting a prediction choice. )r-rErs rrEzDomainURL.get_auto_separators227;;rcy)Nz rrs rr>zDomainURL.get_text_begin_markerrrcyrxrrys rr{zDomainURL.can_spell_checkr|rN)r&r'r(r)rrEr>r{rrrrrs!.< rrceZdZdZgdZgdZgdZeeezezZgdZ ddgZ e e zZ e jde jZd Zd Zd Zd Zd ZdZedZy)r,aA Parse partial URLs and predict separators. Parsing is neither complete nor RFC prove but probably doesn't have to be either. The goal is to save key strokes for the most common cases. Doctests: >>> p = PartialURLParser() >>> p.tokenize_url('http://user:pass@www.do-mai_n.nl/path/name.ext') ['http', '://', 'user', ':', 'pass', '@', 'www', '.', 'do-mai_n', '.', 'nl', '/', 'path', '/', 'name', '.', 'ext'] >>> p.tokenize_url('user:pass@www.do-mai_n.nl/path/name.ext') ['user', ':', 'pass', '@', 'www', '.', 'do-mai_n', '.', 'nl', '/', 'path', '/', 'name', '.', 'ext'] >>> p.tokenize_url('www.do-mai_n.nl/path/name.ext') ['www', '.', 'do-mai_n', '.', 'nl', '/', 'path', '/', 'name', '.', 'ext'] >>> p.tokenize_url('www.do-mai_n.nl') ['www', '.', 'do-mai_n', '.', 'nl'] )aeroasiabizcatcomcooprintjobsmobimuseumnamenetorgproteltravelxxx)edugovmil)acadaeafagaialamanaoaqarasatauawaxazbabbbdbebfbgbhbibjbmbnbobrbsbtbvbwbybzcacccdcfcgchcickclcmcncocrcscucvcxcyczdddedjdkdmdodzeceeegehereseteufifjfkfmfofrgagbgdgegfggghgiglgmgngpgqgrgsgtgugwgyhkhmhnhrhthuidieiliminioiqirisitjejmjojpkekgkhkikmknkpkrkwkykzlalblclilklrlsltlulvlymamcmdmemgmhmkmlmmmnmompmqmrmsmtmumvmwmxmymznancnenfngninlnonpnrnunzompapepfpgphpkplpmpnprpsptpwpyqarBrorsrurwsasbscsdsesgshsisjskslsmsnsosrssstsusvsysztctdtftgthtjtktltmtntotptrtttvtwtzuaugukusuyuzvavcvevgvivnvuwfwsyeytyuzazmzw)httphttpsftpfilemailtoaptz([\w-]+)|(\W+)c8|jj|Sr) _url_patternr)rrMs riter_urlzPartialURLParser.iter_urls  ))#..rc~|j|Dcgc]}|jD]}||c}}Scc}}wr)rgroups)rrMrrs r tokenize_urlzPartialURLParser.tokenize_urlsL"&--"4G"',,.G GuG GGs 9cV|j|}t|dk\r*|d}|d}||jvr|jdryt|dk\rA|ddk(r9|ddk(r1 |j d }|d k\r|d |}n|}|d |j vryy #t $rd}Y-wxYw)a Is this maybe something looking like an URL? Doctests: >>> p = PartialURLParser() >>> p.is_maybe_url("http") False >>> p.is_maybe_url("http:") True >>> p.is_maybe_url("http://www.domain.org") True >>> p.is_maybe_url("www.domain.org") True >>> p.is_maybe_url("www.domain") False >>> p.is_maybe_url("www") False rrr^:T./Nr$F)rrS _all_schemes startswithindex ValueError_TLDs)rrHrtokenseptokr!hostnames rrDzPartialURLParser.is_maybe_urls&""7+ v;! AYEAYF)))f.?.?.D v;! ayCF1I$4"LL-EA:%fu~H%HB<4::-"Es)B B('B(c d|vS)Nrr)rrKs rrGz#PartialURLParser._is_maybe_filenames 6M !rcd}td\}}}}|}d}t|j|} t| D]\} } | j } | d} | d}|r|}| t | dz kr| | dzj d}nd}||k(r4| r2| dk(rd}|}b| |j vrd}|}u| |jvrd }|}|}||k(r!| rd }|d k(r|d k7r| |jvrd }|}||k(rd}||k(sd}||k(r<|s:d }|j|r |t |d}|j|}n|d k(sd }|d }|S)a Get word separator to add after inserting a prediction choice. Doctests: >>> p = PartialURLParser() >>> p.get_auto_separator("http") '://' >>> p.get_auto_separator("www") '.' >>> p.get_auto_separator("domain.org") '/' >>> p.get_auto_separator("www.domain.org") '/' >>> p.get_auto_separator("http://www.domain") '.' >>> p.get_auto_separator("http://www.domain.org") '/' >>> p.get_auto_separator("http://www.domain.co") # ambiguous co/ or co.uk/ '/' >>> p.get_auto_separator("http://www.domain.co.uk") '/' >>> p.get_auto_separator("http://www.domain.co.uk/home") '/' >>> p.get_auto_separator("http://www.domain.co/home") '/' >>> p.get_auto_separator("http://www.domain.org/home") '/' >>> p.get_auto_separator("http://www.domain.org/home/index.html") '' >>> p.get_auto_separator("mailto") ':' # local files >>> import tempfile >>> from os.path import abspath, dirname, join >>> def touch(fn): ... with open(fn, mode="w") as f: n = f.write("") >>> td = tempfile.TemporaryDirectory(prefix="test onboard _") >>> dir = td.name >>> touch(join(dir, "onboard-defaults.conf.example")) >>> touch(join(dir, "onboard-defaults.conf.example.another")) >>> >>> import glob >>> #glob.glob(dir+"/**") >>> p.get_auto_separator("file") ':///' >>> p.get_auto_separator("file:///home") '/' >>> p.get_auto_separator("file://"+join(dir, "onboard-defaults")) '.' >>> p.get_auto_separator("file://"+join(dir, "onboard-defaults.conf")) '.' >>> p.get_auto_separator("file://"+join(dir, "onboard-defaults.conf.example")) '' >>> p.get_auto_separator("file://"+join(dir, "onboard-defaults.conf.example.another")) ' ' # Non-existing filename: we don't know, don't guess a separator >>> p.get_auto_separator("file:///tmp/onboard1234") '' # Non-existing filename: if basename has an extension assume we're done >>> p.get_auto_separator("file:///tmp/onboard1234.txt") ' ' # Relative filename: we don't know current dir, return empty separator >>> p.get_auto_separator("file://tmp") '' Nrr=rr^rz:///z://rrrrAr@) rQrrrdrrS_schemes _protocolsr#r _get_filename_separator)rrHrISCHEMEPROTOCOLDOMAINPATH component last_septokrr!rrr$r% next_septok file_schemefilenames rrEz#PartialURLParser.get_auto_separatorsP ).q&&$   g./%g.+ LE5\\^FAYEAYF$ s7|A~%%eAg.557:  F"$* $(   -$) $*  $//1$' $,  $* F" #I"c)"c) *$' $(  D  H$ W+ Z  Y#K!!+."3{#3#45 88B "c) #I  Yrc(d}tjj|rEtj|dz}|tj|dzz }|j ||}|)tjj |}d|vrd}|Sd}|S)z< Get auto separator for a partial filename. NrPz/*rr@r=)rUrVrWrY_get_separator_from_file_listbasename)rr4rIr\r7s rr+z(PartialURLParser._get_filename_separators 77== "YYx#~.E TYYx$/ /E::8UKI  ww''1Hh  rc 2d}t|}t|Dcgc]}|j|r|||dzc}}t|dk(r d|vrd|vrd}|St|dk(rd|vrd}|St|dk(r|j}|S|rd}|Scc}w)a Extract separator from a list of matching filenames. Doctests: >>> p = PartialURLParser # no matching files: return None, assume new file we can't check >>> p._get_separator_from_file_list("/dir/file", []) # complete file: we're done, continue with space separator >>> p._get_separator_from_file_list("/dir/file.ext", ["/dir/file.ext"]) ' ' # multiple files with identical separator: return that separator >>> p._get_separator_from_file_list("/dir/file", ... ["/dir/file.ext1", "/dir/file.ext2"]) '.' # multiple files with different separators: return empty separator >>> p._get_separator_from_file_list("/dir/file", ... ["/dir/file.ext", "/dir/file-ext"]) '' # directory >>> p._get_separator_from_file_list("/dir", ... ["/dir/file.ext1", "/dir/file.ext2"]) '/' >>> p._get_separator_from_file_list("/dir", ... ["/dir", "/dir/file.ext2"]) '/' # multiple extensions >>> files = ["/dir/dir/file.ext1.ext2", "/dir/dir/file.ext1.ext3"] >>> p._get_separator_from_file_list("/dir/dir/file", files) '.' >>> p._get_separator_from_file_list("/dir/dir/file.ext1", files) '.' >>> p._get_separator_from_file_list("/dir/dir/file.ext1.ext2", files) ' ' # partial path match >>> files = ["/dir/dir/file", "/dir/dir/file.ext1", ... "/dir/dir/file.ext2"] >>> p._get_separator_from_file_list("/dir/dir/file", files) '' >>> p._get_separator_from_file_list("/dir/dir/file.ext1", files) ' ' Nr^rrr=r@)rSsetr pop)r4r\rIrf separatorss rr6z.PartialURLParser._get_separator_from_file_listsd ME4qLL2Aac(45  z?a C:$5" :JI_ !bJ&6I _ !"(I I!4s BN)r&r'r(r)_gTLDs_usTLDs_ccTLDs frozensetr#r)r*rrBrrrrrrDrGrEr+ staticmethodr6rrrr,r,s* F$GG4 fw&0 1E/HE"Jj(L2::/rKs(BA / #*@@ '  L )!!.||~  Y_ _D[%Z[%|!&WWS  sB''B61B6